AV50153
Anti-PCDH15 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-DFNB23, Anti-DKFZp667A1711, Anti-Protocadherin 15, Anti-RP11-449J3.2, Anti-USH1F
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
100 μL
423,00 €
423,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
Seleccione un Tamaño
Cambiar Vistas
100 μL
423,00 €
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
423,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
80 kDa
reactividad de especies
human, guinea pig, rat, rabbit, mouse, bovine
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... PCDH15(65217)
Categorías relacionadas
Descripción general
The gene Protocadherin-related 15 (PCDH15) is mapped to human chromosme 10q21.1. It is an integral membrane protein and one of the members of the cadherin superfamily that mediate calcium-dependent cell-cell adhesion.. PCDH15 transcripts can be detected in adult brain, lung, kidney, fetal retina and fetal cochlea.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human PCDH15
Aplicación
Anti-PCDH15 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Acciones bioquímicas o fisiológicas
The expression of Protocadherin-related 15 (PCDH15) is essential for normal function of cochlea and retina. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). PCDH15 is expressed in nasal NK/T-cell lymphomas.
Secuencia
Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Yinjun Dong et al.
Molecular imaging and biology, 21(1), 175-182 (2018-06-06)
To assess a novel radiotracer aluminum [18F]fluoride-1,4,7-triazacyclononane-triacetic acid-pegylated dimeric RGD ([18F]ALF-NOTA-PRGD2, denoted as [18F]Alfatide) for positron emission tomography (PET)/X-ray computed tomography (CT) and explore the relationships between clinicopathological characteristics and maximum standard uptake values in primary (SUVP) and metastatic lymph
Accessing neuroinflammation sites: Monocyte/neutrophil-mediated drug delivery for cerebral ischemia.
Jia Hou et al.
Science advances, 5(7), eaau8301-eaau8301 (2019-09-19)
Cerebral ischemia (CI) results from inadequate blood flow to the brain. The difficulty of delivering therapeutic molecules to lesions resulting from CI hinders the effective treatment of this disease. The inflammatory response following CI offers a unique opportunity for drug
Rebeca Burgos-Panadero et al.
BMC cancer, 19(1), 479-479 (2019-05-24)
Vitronectin is a multifunctional glycoprotein known in several human tumors for its adhesive role in processes such as cell growth, angiogenesis and metastasis. In this study, we examined vitronectin expression in neuroblastoma to investigate whether this molecule takes part in
Marisa Zallocchi et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(40), 13841-13859 (2012-10-05)
Usher syndrome is a genetically heterogeneous disorder characterized by hearing and balance dysfunction and progressive retinitis pigmentosa. Mouse models carrying mutations for the nine Usher-associated genes have splayed stereocilia, and some show delayed maturation of ribbon synapses suggesting these proteins
V Rouget-Quermalet et al.
Oncogene, 25(19), 2807-2811 (2005-12-22)
Natural killer cells are well known to play an important role in immune defense against tumor development and viral infections. To further characterize new functionally relevant structures in these cells, we studied a series of monoclonal antibodies that we have
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
