Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV49937

Sigma-Aldrich

Anti-ADAM33 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-ADAM metallopeptidase domain 33, Anti-DJ964F7.1, Anti-DKFZp434K0521, Anti-FLJ35308, Anti-FLJ36751, Anti-MGC149823, Anti-MGC71889

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

62 kDa

reactividad de especies

dog, rat, human, mouse, pig, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ADAM33(80332)

Descripción general

ADAM metallopeptidase domain 33 (ADAM33) is a member of the ADAM (a disintegrin and metalloprotease domain) family. ADAM33 is largely expressed in mesenchymal cells including airway fibroblasts, myofibroblasts, and smooth muscle cells.

Inmunógeno

Synthetic peptide directed towards the middle region of human ADAM33

Aplicación

Anti-ADAM33 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Acciones bioquímicas o fisiológicas

The members of the ADAM (a disintegrin and metalloprotease domain) family are involved in cell-to-cell and cell-to-matrix interactions, neurogenesis and muscle development. The expression of ADAM33 has been linked to asthma and chronic obstructive pulmonary disease (characterised by chronic bronchitis and emphysema). ADAM33 is also associated with inflammation of the lungs which is activated against etiological viral agents.

Secuencia

Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Shelby P Umland et al.
American journal of respiratory cell and molecular biology, 29(5), 571-582 (2003-06-05)
We examined transcript expression and post-transcriptional regulation of human ADAM33, a recently identified asthma gene. A detailed messenger RNA (mRNA) expression profile was obtained using Northern, reverse transcription polymerase chain reaction, and in situ hybridization analyses. ADAM33 mRNA was expressed
Deng-Chuan Zhou et al.
Molecular biology reports, 42(2), 409-422 (2014-10-05)
A series of observational studies have been made to investigate the association of the ADAM33 gene polymorphisms with the risk of COPD, but their results were conflicting. Therefore, we performed an updated meta-analysis to quantitatively summarize the associations of ADAM33
Feng Lin et al.
Molecular medicine reports, 8(4), 1209-1215 (2013-08-13)
A disintegrin and metalloproteinase 33 (ADAM33) has been identified as an asthma susceptibility gene; however, the role of ADAM33 in the pathogenesis and progression of asthma remains to be elucidated. As ADAM33 is predominantly expressed in airway smooth muscle cells
Emanuele Baurakiades et al.
Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology, 61(4), 585-589 (2014-12-03)
ADAM28, ADAM33, IL-13, IL-4 and other cytokines (IL-6 and IL-10) seem to play important roles in the persistence and maintenance of acute inflammatory processes that ultimately lead to lung remodeling and pulmonary fibrosis, which may be responsible for the high
Paul Van Eerdewegh et al.
Nature, 418(6896), 426-430 (2002-07-12)
Asthma is a common respiratory disorder characterized by recurrent episodes of coughing, wheezing and breathlessness. Although environmental factors such as allergen exposure are risk factors in the development of asthma, both twin and family studies point to a strong genetic

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico