Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV46802

Sigma-Aldrich

Anti-SILV antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-D12S53E, Anti-Gp100, Anti-ME20, Anti-PMEL17, Anti-SI, Anti-SIL, Anti-Silver homolog (mouse)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

70 kDa

reactividad de especies

mouse, human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SILV(6490)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SILV

Aplicación

Anti-SILV antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Acciones bioquímicas o fisiológicas

SILV [Silver homolog (mouse)] gene encodes a melanocyte-specific type I transmembrane glycoprotein expressed primarily in melanocytes and at low levels in normal cell lines and tissues. It facilitates in the structural organization of premelanosomes within multivesicular bodies. The encoded protein is also involved in generating internal matrix fibers that define the transition from stage I to stage II melanosomes.

Secuencia

Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

T Bailin et al.
The Journal of investigative dermatology, 106(1), 24-27 (1996-01-01)
We have determined the DNA sequence and genomic organization of D12S53E (Pmel 17), the human homologue of the mouse silver (si) locus. D12S53E encodes a melanosomal matrix protein whose expression is closely correlated with cellular melanin content and which is
J F Berson et al.
Molecular biology of the cell, 12(11), 3451-3464 (2001-11-06)
Melanosomes are tissue-specific organelles within which melanin is synthesized and stored. The melanocyte-specific glycoprotein Pmel17 is enriched in the lumen of premelanosomes, where it associates with characteristic striations of unknown composition upon which melanin is deposited. However, Pmel17 is synthesized

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico