AV46129

Anti-SHMT2 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-GLYA, Anti-SHMT, Anti-Serine hydroxymethyltransferase 2 (mitochondrial)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 2

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 56 kDa
• species reactivity: horse, dog, rat, guinea pig, mouse, human, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_005403
• UniProt accession no.: P34897
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SHMT2(6472)

Descripción

Immunogen

Synthetic peptide directed towards the C terminal region of human SHMT2

Application

Anti-SHMT2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Biochem/physiol Actions

SHMT2 gene encodes an enzyme serine hydroxymethyltransferase 2 (mitochondrial), which is a pyridoxal phosphate-dependent enzyme that regulates the biosynthesis of thymidylate in mammals. It catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. Additionally, it facilitates the interconversion of serine and glycine and is associated with mitochondrial DNA which assists in preventing the uracil accumulation in mtDNA.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable