Saltar al contenido
Merck
Todas las fotos(3)

Documentos

AV45746

Sigma-Aldrich

Anti-CBS antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Cystathionine-β-synthase, Anti-HIP4

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

60 kDa

reactividad de especies

bovine, horse, rabbit, dog, guinea pig, human, mouse, rat

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CBS(875)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CBS

Acciones bioquímicas o fisiológicas

Cystathionine β-synthase (CBS) is an important enzyme in the transsulfuration metabolic pathway. It transforms homocysteine to cystathionine, which is then converted to cysteine, required for production of the chief retinal antioxidant glutathione (GSH).

Secuencia

Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Phase II study of mitoxantrone in patients with mesothelioma: a National Cancer Institute of Canada Clinical Trials Group Study.
E A Eisenhauer et al.
Cancer treatment reports, 70(8), 1029-1030 (1986-08-01)
Y F Zhou et al.
Journal of dairy science, 101(12), 11384-11395 (2018-10-15)
Insufficient supply of Met and choline (Chol) around parturition could compromise hepatic metabolism and milk protein synthesis in dairy cows. Mechanistic responses associated with supply of Met or Chol in primary liver cells enriched with hepatocytes (PHEP) from cows have

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico