Saltar al contenido
Merck
Todas las fotos(2)

Documentos

AV44073

Sigma-Aldrich

Anti-SLC22A16 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-6-Oct, Anti-CT2, Anti-FLIPT2, Anti-OKB1, Anti-Solute carrier family 22 (organic cation transporter), member 16, Anti-dJ261K5.1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

63 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_149116

Nº de acceso UniProt

Q86VW1

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC22A16(85413)

Categorías relacionadas

Descripción general

The previously assigned protein identifier Q96RU0 has been merged into Q86VW1. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLC22A16

Aplicación

Anti-SLC22A16 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

SLC22A16 (CT2; OAT6) is an organic zwitterion transporter protein that transports l-carnitine, a component of mitochondrial fatty acid beta-oxidation process. The transporter does not accept OCT/OCTN cationic or OAT anionic substrates. CT2 is specifically expressed in luminal membrane of epididymal epithelium and within the Sertoli cells of the testis. Human CT2 reportedly mediates the uptake of polyamines and the anticancer drug bleomycin-A5.

Secuencia

Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Mustapha Aouida et al.
The Journal of biological chemistry, 285(9), 6275-6284 (2009-12-29)
Bleomycin is used in combination with other antineoplastic agents to effectively treat lymphomas, testicular carcinomas, and squamous cell carcinomas of the cervix, head, and neck. However, resistance to bleomycin remains a persistent limitation in exploiting the full therapeutic benefit of
Atsushi Enomoto et al.
The Journal of biological chemistry, 277(39), 36262-36271 (2002-06-29)
l-Carnitine is an essential component of mitochondrial fatty acid beta-oxidation and plays a pivotal role in the maturation of spermatozoa within the male reproductive tract. Epididymal plasma contains the highest levels of l-carnitine found in the human body, and initiation
Yan Wu et al.
Apoptosis : an international journal on programmed cell death, 20(8), 1099-1108 (2015-05-23)
AML (acute myeloid leukemia) cells have a unique reliance on mitochondrial metabolism and fatty acid oxidation (FAO). Thus, blocking FAO is a potential therapeutic strategy to target these malignant cells. In the current study, we assessed plasma membrane carnitine transporters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico