AV43838

Anti-SLC7A1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ATRC1, Anti-CAT-1, Anti-ERR, Anti-HCAT1, Anti-REC1L, Anti-Solute carrier family 7 (cationic amino acid transporter, y⁺ system), member 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 68 kDa
• species reactivity: human, rabbit, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003036
• UniProt accession no.: P30825
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC7A1(6541)

Descripción

General description

Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1/ high affinity cationic amino acid transporter 1 (SLC7A1, ATRC1, CAT-1, ERR, REC1L) is a y+ system cationic amino acid transporter family member that supports arginine uptake and nitric oxide (NO) production. Mouse CAT-1 is a viral receptor for ecotropic murine leukemia virus (MLV) (eMLV), making it a model for study of retrovirus infection mechanisms and pathogenesis.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC7A1

Application

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 in cationic amino acid uptake and retrovirus infection mechanisms and pathogenesis.

Biochem/physiol Actions

Anti-SLC7A1 polyclonal antibody reacts with human and pig solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 proteins.

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• ¿Qué está pasando?: WGK 3
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable