Saltar al contenido
Merck
Todas las fotos(3)

Documentos

AV42101

Sigma-Aldrich

Anti-SQLE antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FLJ30795, Anti-Squalene epoxidase

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

39 kDa

reactividad de especies

human, bovine, rabbit, mouse, sheep

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SQLE(6713)

Descripción general

Squalene epoxidase (SQLE) is an NADPH-dependent flavoprotein monooxygenase that oxidizes squalene to 2,3,-oxidosqualene (squalene epoxide) which is the first oxygenation and rate-limiting step in sterol, ergosterol and cholesterol, biosynthesis.

Especificidad

Anti-SQLE polyclonal antibody reacts with human, mouse, rat, pig, zebrafish, bovine, and canine squalene epoxidases.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SQLE

Aplicación

Anti-SQLE polyclonal antibody is used to tag squalene epoxidase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of squalene epoxidase in sterol, ergosterol and cholesterol, biosynthesis.

Acciones bioquímicas o fisiológicas

Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Secuencia

Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico