AV41562
Anti-HMGCS2 (AB1) antibody produced in rabbit
IgG fraction of antiserum, lyophilized powder
Sinónimos:
Anti-3-Hydroxy-3-methylglutaryl-coenzyme A synthase 2 (mitochondrial)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
Productos recomendados
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
lyophilized powder
mol peso
56 kDa
reactividad de especies
canine, human, horse, rat, pig, rabbit, mouse, chicken, bovine
técnicas
western blot: suitable
secuencia del inmunógeno
FSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYT
Nº de acceso NCBI
Nº de acceso UniProt
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... HMGCS2(3158)
Descripción general
HMG-coenzyme A synthase 2 (mitochondrial) (HMGCS2) is the mitochondrial form of HMG-CoA synthase, the enzyme that catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA. HMG-CoA synthase 2 regulates and rate-limits ketone body production and mitochondrial fatty acid oxidation within liver cells and some extrahepatic tissues such as the colon.
Especificidad
Anti-HMGCS2 (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, canine, pig, and chicken HMG-coenzyme A synthase 2 proteins.
Inmunógeno
synthetic peptide corresponding to a region of human HMGCS2 with an internal ID of P24247
Aplicación
Anti-HMGCS2 (AB1) polyclonal antibody is used to tag the HMG-coenzyme A synthase 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of HMG-coenzyme A synthase 2 in ketone body production and mitochondrial fatty acid oxidation within hepatic and other tissues.
Forma física
Lyophilized from PBS buffer with 2% sucrose
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Maria M Mihaylova et al.
Cell stem cell, 22(5), 769-778 (2018-05-05)
Diet has a profound effect on tissue regeneration in diverse organisms, and low caloric states such as intermittent fasting have beneficial effects on organismal health and age-associated loss of tissue function. The role of adult stem and progenitor cells in
Chia-Wei Cheng et al.
Cell, 178(5), 1115-1131 (2019-08-24)
Little is known about how metabolites couple tissue-specific stem cell function with physiology. Here we show that, in the mammalian small intestine, the expression of Hmgcs2 (3-hydroxy-3-methylglutaryl-CoA synthetase 2), the gene encoding the rate-limiting enzyme in the production of ketone
Ubaldo E Martinez-Outschoorn et al.
Cell cycle (Georgetown, Tex.), 11(21), 3964-3971 (2012-10-23)
We have previously proposed that catabolic fibroblasts generate mitochondrial fuels (such as ketone bodies) to promote the anabolic growth of human cancer cells and their metastasic dissemination. We have termed this new paradigm "two-compartment tumor metabolism." Here, we further tested
Semir Beyaz et al.
Nature, 531(7592), 53-58 (2016-03-05)
Little is known about how pro-obesity diets regulate tissue stem and progenitor cell function. Here we show that high-fat diet (HFD)-induced obesity augments the numbers and function of Lgr5(+) intestinal stem cells of the mammalian intestine. Mechanistically, a HFD induces
Victoire Gouirand et al.
The EMBO journal, 41(9), e110466-e110466 (2022-03-22)
Pancreatic ductal adenocarcinoma (PDA) tumor cells are deprived of oxygen and nutrients and therefore must adapt their metabolism to ensure proliferation. In some physiological states, cells rely on ketone bodies to satisfy their metabolic needs, especially during nutrient stress. Here
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
