AV40257

Anti-RBMy1A1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-RBM1, Anti-RBM2, Anti-RBMY, Anti-RNA binding motif protein, Y-linked, family 1, member A1, Anti-YRRM1, Anti-YRRM2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 41 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001007527
• Nº de acceso UniProt: Q15414
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... RBMY1A1(5940)

Descripción

Descripción general

RNA binding motif protein, γ-linked, family 1, member A1 (RBMy1A1, γRRM1, γRRM2) is a germ-cell specific nuclear RNA-binding protein involves in spermatogenesis. RBMγ binds to RNA stem-loops capped by a C(A)/(U)CAA pentaloops and participates in splicing within the testis by modulating the activity of constitutively expressed splicing factors.

Especificidad

Anti-RBMy1A1 polyconal antibody reacts with chicken, human, mouse, rat, canine, and bovine RNA binding motif protein, γ-linked, family 1, member A1 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human RBMY1A1

Aplicación

Anti-RBMy1A1 polyconal antibody is used to tag RNA binding motif protein, γ-linked, family 1, member A1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein, γ-linked, family 1, member A1 in spermatogenesis.

Acciones bioquímicas o fisiológicas

RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Secuencia

Synthetic peptide located within the following region: MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable