Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV40182

Sigma-Aldrich

Anti-HOMER1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-HOMER1A, Anti-HOMER1B, Anti-HOMER1C, Anti-Homer homolog 1 (Drosophila), Anti-SYN47, Anti-Ves-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
498,00 €

498,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
498,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

498,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

39 kDa

reactividad de especies

pig, rabbit, human, rat, dog, horse, bovine, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HOMER1(9456)

Descripción general

Homer proteins are cytoplasmic adaptor proteins that contain the Ena/VASP homology 1 domain that binds to the PPXXF sequence motifs found in Ca2+ handling proteins such as IP3 receptors, transient receptor potential canonical (TRPC) channels and ryanodine receptor (RyR) Ca2+ release channels. HOMER1, a calcium signaling complex modulator, is involved in the opening and closing of TRPC channels such as the endoplasmic reticulum store-operated Ca2+ -influx channels (SOCs). Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL, an apoptotic cell death-inducing ligand that belongs to a TNF superfamily.

Especificidad

Anti-HOMER1 (AB2) polclonal antibody reacts with canine, human, mouse, rat, and bovine homer 1 adaptor proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human HOMER1

Aplicación

Anti-HOMER1 (AB2) polclonal antibody is used to tag the homer 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of homer 1 as a modulator of calcium transport and signaling involved in apoptosis, body movement and various cellular processes.

Acciones bioquímicas o fisiológicas

HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Secuencia

Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico