Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV40071

Sigma-Aldrich

Anti-RNF8 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-FLJ12013, Anti-KIAA0646, Anti-Ring finger protein 8

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
326,00 €

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
326,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

55 kDa

reactividad de especies

pig, mouse, bovine, rat, human, horse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RNF8(9025)

Descripción general

Ring finger protein 8 (RNF8) is an E3 ubiquitin ligase which ubiquitinates proteins for degradation by proteosomes. RNF8 is involved in DNA double-strand break (DSB) repair, wherein RNF8 and RNF168 control the recruitment of 53BP1 to DNA damage sites and ubiquitination of histone-2A. RNF8 also mediates chromatin decondensation to create a local chromatin environment that is permissive to the assembly of checkpoint and repair machineries at DNA lesions.

Especificidad

Anti-RNF8 polyclonal antibody reacts with human, mouse, rat, and bovine ring finger protein 8 proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human RNF8

Aplicación

Anti-RNF8 polyclonal antibody is used to tag ring finger protein 8 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles ring finger protein 8 in processes such as DNA double-strand break (DSB) repair.

Acciones bioquímicas o fisiológicas

RNF8 contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins.The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Secuencia

Synthetic peptide located within the following region: MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

M Dafne Cardamone et al.
Cell reports, 8(1), 163-176 (2014-06-24)
Timely and selective recruitment of transcription factors to their appropriate DNA-binding sites represents a critical step in regulating gene activation; however, the regulatory strategies underlying each factor's effective recruitment to specific promoter and/or enhancer regions are not fully understood. Here

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico