Synthetic peptide directed towards the middle region of human NUCB2
Acciones bioquímicas o fisiológicas
NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating regulation in the hypothalamus. It is an important prognostic marker in prostate cancer, promotes osteogenesis and has been identified as anorexigenic and anti-hyperglycemic protein.
Secuencia
Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
NUCB2¹⁻⁸³ has been recently reported as an anorexigenic and anti-hyperglycemic peptide. Here we report that NUCB2¹⁻⁸³ promotes osteogenesis. It was found after two months of once-a-day intravenous injection of NUCB2¹⁻⁸³, bone mineral density of femora and lumbar vertebrae were increased
Journal of experimental & clinical cancer research : CR, 32, 77-77 (2014-01-16)
Nucleobindin 2 (NUCB2) protein, a novel oncoprotein, is overexpressed in breast cancer. To date, there have been no published data regarding the role of NUCB2 protein expression in prostate cancer (PCa). Therefore, this study was performed to investigate the correlations
Journal of experimental & clinical cancer research : CR, 32(1), 56-56 (2013-08-21)
Nucleobindin 2 (NUCB2) abnormal expression has been reported in gastric cancer and breast cancer. However, the role of NUCB2 in prostate cancer (PCa) remains unclear. The aim of the present study was to investigate the NUCB2 expression in PCa tissues
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
