AV35341

Anti-GRIK2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Glutamate receptor, ionotropic, kainate 2
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 98 kDa
• species reactivity: bovine, guinea pig, human, rabbit, dog, horse, rat, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_068775
• UniProt accession no.: Q96KS6
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GRIK2(2898)

Descripción

General description

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).
Rabbit Anti-GRIK2 antibody recognizes canine, human, mouse, rat, bovine, and zebrafish GRIK2.

Immunogen

Synthetic peptide directed towards the C terminal region of human GRIK2

Application

Rabbit Anti-GRIK2 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.

Biochem/physiol Actions

This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable