Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV34548

Sigma-Aldrich

Anti-TRIM17 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Tripartite motif-containing 17

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
287,00 €

287,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
287,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

287,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

54 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TRIM17(51127)

Descripción general

TRIM17 (Terf) is an E3 ubiquitin ligase that mediates Mcl-1 degradation and initiates apoptosis in neurons. Terf can also facilitate the degradation of ZWINT (a kinetochore protein) and decrease the proliferation of MCF7 breast cancer cells.
Rabbit Anti-TRIM17 antibody recognizes human TRIM17.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TRIM17

Aplicación

Rabbit Anti-TRIM17 (AB2) antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Acciones bioquímicas o fisiológicas

TRIM17 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene.

Secuencia

Synthetic peptide located within the following region: PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Hiroshi Endo et al.
Journal of biochemistry, 151(2), 139-144 (2011-10-26)
Terf/TRIM17 is a tripartite motif protein that has been originally isolated from testis. Terf has been characterized to exhibit an E3 ubiquitin ligase activity and to undergo self-ubiquitination. The cellular function of terf and its substrates, however, remain elusive. In
I Lassot et al.
Cell death and differentiation, 17(12), 1928-1941 (2010-06-19)
Accumulating data indicate that the ubiquitin-proteasome system controls apoptosis by regulating the level and the function of key regulatory proteins. In this study, we identified Trim17, a member of the TRIM/RBCC protein family, as one of the critical E3 ubiquitin
M M Magiera et al.
Cell death and differentiation, 20(2), 281-292 (2012-09-15)
Short-term proteasome inhibition has been shown to prevent neuronal apoptosis. However, the key pro-survival proteins that must be degraded for triggering neuronal death are mostly unknown. Here, we show that Mcl-1, an anti-apoptotic Bcl-2 family member, is degraded by the

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico