AV34374

Anti-CRIP2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Cysteine-rich protein 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 22 kDa
• reactividad de especies: human, guinea pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001303
• Nº de acceso UniProt: P52943
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... CRIP2(1397)

Descripción

Descripción general

Cysteine-rich protein 2 (CRIP2) is a LIM-domain protein that can function as a transcriptional repressor of NF-κB-mediated expression of proangiogenic cytokines. Hence, CRIP2 can inhibit angiogenesis and cancer formation[1]. It can also facilitate apoptosis in esophageal squamous cell carcinoma[2].
Rabbit Anti-CRIP2 recognizes bovine, human, mouse, and rat CRIP2.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CRIP2

Aplicación

Rabbit Anti-CRIP2 can be used for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

Human ESP1/CRP2 protein has two LIM domains, and each shares 35.1% and 77 or 79% identical residues with human cysteine-rich protein (CRP) and rat CRIP, respectively. Northern blot analysis of ESP1/CRP2 in various human tissues showed distinct tissue distributions compared with CRP and CRIP, suggesting that each might serve related but specific roles in tissue organization or function. Using a panel of human-rodent somatic cell hybrids, the ESP1/CRP2 locus was assigned to chromosome 14. Fluorescence in situ hybridization, using cDNA and a genome DNA fragment of the ESP1/CRP2 as probes, confirms this assignment and relegates regional localization to band 14q32.3.

Secuencia

Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable