Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

AV32797

Sigma-Aldrich

Anti-SCD antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Stearoyl-CoA desaturase (δ-9-desaturase)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

41 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SCD(6319)

Descripción general

Rabbit polyclonal anti-SCD antibody reacts with human and bovine stearoyl-CoA desaturases.
Stearoyl-CoA desaturase (SCD) is a rate-limiting enzyme that catalyses the conversion of saturated fatty acids to monounsaturated fatty acids (MUFA). SCD functions as a homeostatic check-point between glucose and fatty acid metabolism. It is a key enzyme target in the search for potential drugs to manage obesity.

Inmunógeno

Synthetic peptide directed towards the middle region of human SCD

Aplicación

Rabbit Anti-SCD antibody can be used for western blot applications at a concentration of 1.0 μg/ml. It can also be used for IHC at 4-8 μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-SCD antibody is used to tag stearoyl-CoA desaturase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of stearoyl-CoA desaturases in the homeostasis of fatty acid metabolism at the level of monounsaturation.

Acciones bioquímicas o fisiológicas

Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Secuencia

Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ana S H Costa et al.
PloS one, 13(4), e0193875-e0193875 (2018-04-04)
Despite the recent advances in transcriptomics, gene expression studies addressing cattle´s skeletal muscle adaptations in response to compensatory growth are warranted, particularly regarding lipid metabolism due to its impact in meat sensory and nutritional traits. In the present study, in

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico