Nuclear receptor co-repressor 1/thyroid-hormone- and retinoic-acid-receptor-associated co-repressor 1 (NCOR1, TRAC-1) is a transcriptional coregulatory protein that recruits histone deacetylases to DNA promoter regions and assists nuclear receptors in the down regulation of RNA expression. NCOR1 controls thyroid hormone sensitivity and the set point of the hypothalamic-pituitary-thyroid axis. NCOR1 plays an adaptive role in muscle physiology.
Rabbit polyclonal anti-NCOR1 antibody reacts with human, canine, and mouse nuclear receptor co-repressor 1 transcriptional coregulatory proteins.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human NCOR1
Aplicación
Rabbit Anti-NCOR1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-NCOR1 antibody is used to tag nuclear receptor co-repressor 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of nuclear receptor co-repressor 1 in the hypothalamic-pituitary-thyroid axis regulation and muscle physiology.
Acciones bioquímicas o fisiológicas
NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.
Secuencia
Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
International journal of biological sciences, 16(15), 2974-2988 (2020-10-17)
Sepsis-induced myocardial dysfunction (SIMD) is a life-threatening complication caused by inflammation, but how it is initiated is still unclear. Several studies have shown that extracellular high mobility group box 1 (HMGB1), an important cytokine triggering inflammation, is overexpressed during the
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
