Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV32470

Sigma-Aldrich

Anti-SUV39H1 Histone Methyltransferase antibody

rabbit polyclonal

Sinónimos:

Anti-KMT1A, Anti-MG44, Anti-SUV39H, Anti-Suppressor of variegation 3-9 homolog 1 (Drosophila)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
326,00 €

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
326,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Nombre del producto

Anti-SUV39H1 antibody produced in rabbit, IgG fraction of antiserum

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

48 kDa

reactividad de especies

rat, bovine, guinea pig, dog, rabbit, mouse, human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SUV39H1(6839)

Descripción general

Rabbit polyclonal anti-SUV39H1 antibody reacts with human, mouse, rat, zebrafish, bovine, and canine suppressor of variegation 3-9 homolog 1 enzymes.
Suppressor of variegation 3-9 homolog 1 (SUV39H1, KMT1A, MG44) is a histone-lysine N-methyltransferase that methylates lys-9 of histone H3. SUV39H1 is involved in heterochromatin organization, chromosome segregation, and mitotic progression. SUV39H1 generates a gradient of methylation marks at the kinetochore to spatiotemporally direct accurate chromosome segregation in mitosis. Suv39H1 interacts with Snail to mediated E-cadherin, a hallmark of epithelial-mesenchymal transition (EMT), repression in breast cancer.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SUV39H1

Aplicación

Rabbit Anti-SUV39H1 antibody can be used for western blot applications at a concentration of 1.25μg/ml.
Rabbit polyclonal anti-SUV39H1 antibody is used to tag suppressor of variegation 3-9 homolog 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of suppressor of variegation 3-9 homolog 1 in the regulation of chromatin organization and chromosome segregation and as a regulator or cancer progression via E-cadherin-dependent epithelial-mesenchymal transition (EMT).

Acciones bioquímicas o fisiológicas

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Secuencia

Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yan Chen et al.
PeerJ, 12, e17222-e17222 (2024-04-23)
Targeting tumor angiogenesis is an important approach in advanced tumor therapy. Here we investigated the effect of the suppressor of variegation 3-9 homolog 1 (SUV39H1) on tumor angiogenesis in oral squamous cell carcinoma (OSCC). The GEPIA database was used to
Svetlana Sharifulina et al.
International journal of molecular sciences, 22(22) (2021-11-28)
Cerebral ischemia, a common cerebrovascular disease, is one of the great threats to human health and new targets for stroke therapy are needed. The transcriptional activity in the cell is regulated by epigenetic processes such as DNA methylation/demethylation, acetylation/deacetylation, histone

Preguntas

  1. What is the similarity between the immunogen and the zebrafish protein in the anti-SUV39H1 antibody (AV32470) that I'm considering for use in zebrafish?

    1 respuesta
    1. Based on the immunogen sequence, the homology is as follows: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%.

      ¿Le ha resultado útil?

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico