TFEC is a basic helix-loop-helix protein that forms heterodimers with TFE3 and subsequently blocks transcriptional stimulation. TFEC may be involved in the regulation of macrophage-specific genes. RabbitAnti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human TFEC
Aplicación
RabbitAnti-TFEC antibody can be used for western blot applications at a concentration of 0.25μg/ml.
Acciones bioquímicas o fisiológicas
TFEC is an activator of transcription with two separate activation domains.
Secuencia
Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Clinical cancer research : an official journal of the American Association for Cancer Research, 24(23), 5977-5989 (2018-08-01)
Translocation renal cell carcinoma (tRCC) represents a rare subtype of kidney cancer associated with various TFE3, TFEB, or MITF gene fusions that are not responsive to standard treatments for RCC. Therefore, the identification of new therapeutic targets represents an unmet
Journal of immunology (Baltimore, Md. : 1950), 162(3), 1559-1565 (1999-02-11)
The murine homologue of the TFEC was cloned as part of an analysis of the expression of the microphthalmia-TFE (MiT) subfamily of transcription factors in macrophages. TFEC, which most likely acts as a transcriptional repressor in heterodimers with other MiT
Molecular and cellular biology, 13(8), 4505-4512 (1993-08-01)
We have identified a new basic helix-loop-helix (BHLH) DNA-binding protein, designated TFEC, which is closely related to TFE3 and TFEB. The basic domain of TFEC is identical to the basic DNA-binding domain of TFE3 and TFEB, whereas the helix-loop-helix motif
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
