AV32006

Anti-SMAD5 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-SMAD family member 5
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 51 kDa
• reactividad de especies: bovine, mouse, rabbit, horse, human, rat, guinea pig, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001001419
• Nº de acceso UniProt: Q99717
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SMAD5(4090)

Descripción

Descripción general

SMAD5 is known to mediate TGFβ signaling. Studies in mice have shown that Smad5 mutations can be linked to angiogenic defects, mesenchymal apoptosis and embryonic death.
Rabbit Anti-SMAD5 antibody recognizes bovine, chicken, human, mouse, rat, zebrafish, and canine SMAD5.

Inmunógeno

Synthetic peptide directed towards the middle region of human SMAD5

Aplicación

Rabbit Anti-SMAD5 antibody can be used for western blot applications at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.

Secuencia

Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable