ERF is a transcription factor that belongs to the ETS family of proteins and regulates cell growth. Reduced ERF dosage has been linked to complex craniosynostosis in humans. Rabbit Anti-ERF antibody recognizes human, mouse, rat, and zebrafish ERF.
Inmunógeno
Synthetic peptide directed towards the C terminal region of human ERF
Aplicación
Rabbit Anti-ERF antibody can be used for western blot applications at a concentration of 1μg/ml.
Acciones bioquímicas o fisiológicas
Members of the ETS family of transcription factors, such¡¡as ERF, regulate cell proliferation and differentiation. They share¡¡a highly conserved DNA-binding domain, the ETS domain, that¡¡recognizes the sequence GGAA/T.Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-56 DC299706.1 1-56 57-2698 BC022231.1 1-2642 2699-2705 BM905776.1 207-213
Secuencia
Synthetic peptide located within the following region: GGLAEGAGALAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKT
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Biochemical and biophysical research communications, 168(2), 857-862 (1990-04-30)
To clarify the interactions between mononuclear cells and polymorphonuclear leukocytes, and to identify the cytokine(s) that mediate the interaction, the effects of a culture supernatant of LPS-stimulated mononuclear cells on production of arachidonic acid metabolites of polymorphonuclear cells were studied.
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.