Synthetic peptide directed towards the C terminal region of human PACSIN1
Aplicación
Anti-PACSIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Acciones bioquímicas o fisiológicas
PACSIN1 is a neuron-specific member of PACSIN family, specifically expressed in human and mouse plasmacytoid dendritic cells. PACSIN1 interacts with tubulin and regulates membrane deformation, linking membrane trafficking and actin organization. It binds with Tau protein in axon and regulates axonal elongation.
Secuencia
Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
European journal of immunology, 42(3), 573-579 (2012-04-11)
Plasmacytoid dendritic cells (pDCs) are the professional interferon (IFN)-producing cells of the immune system. pDCs specifically express Toll-like receptor (TLR)7 and TLR9 molecules and produce massive amounts of type I IFN by sensing microbial nucleic acids via TLR7 and TLR9.
The Journal of biological chemistry, 287(47), 39911-39924 (2012-10-05)
Tau is a major member of the neuronal microtubule-associated proteins. It promotes tubulin assembly and stabilizes axonal microtubules. Previous studies have demonstrated that Tau forms cross-bridges between microtubules, with some particles located on cross-bridges, suggesting that some proteins interact with
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
