AV09037

Anti-SREBF2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-SREBP2, Anti-Sterol Regulatory element binding transcription factor 2
• UNSPSC Code: 12352203
• NACRES: NA.41
• MDL number: MFCD02264111
• eCl@ss: 32160702
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 124 kDa
• species reactivity: rat, guinea pig, dog, human, bovine, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004590
• UniProt accession no.: Q12772
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SREBF2(6721)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human SREBF2

Application

Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8⁺ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• WGK: WGK 3
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable