Synthetic peptide directed towards the C terminal region of human RNASEL
Aplicación
Anti-RNASEL antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Acciones bioquímicas o fisiológicas
Endoribonuclease L (RNaseL) is an enzyme activated by its allosteric activator 2′,5′-linked oligoadenylates (2-5A). The 2-5A/RNaseL system is induced by interferons and cleaves single-stranded RNA molecules in U-rich sequences. This pathway mediates immunomodulatory, antiviral and antiproliferative effects.
Secuencia
Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, 31(1), 49-57 (2010-12-31)
The interferon (IFN)-inducible 2'-5'-oligoadenylate synthetase (OAS)/RNase L pathway blocks infections by some types of viruses through cleavage of viral and cellular single-stranded RNA. Viruses induce type I IFNs that initiate signaling to the OAS genes. OAS proteins are pathogen recognition
Frontiers in bioscience (Scholar edition), 4, 767-786 (2011-12-29)
The endoribonuclease RNase-L is the terminal component of an RNA cleavage pathway that mediates antiviral, antiproliferative and immunomodulatory activities. Inactivation or dysregulation of RNase-L is associated with a compromised immune response and increased risk of cancer, accordingly its activity is
The endoribonuclease L (RNase L) is the effector of the 2-5A system, a major enzymatic pathway involved in the molecular mechanism of interferons (IFNs). RNase L is a very unusual nuclease with a complex mechanism of regulation. It is a
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
