AV01026

Anti-CREB1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-CREB, Anti-MGC9284, Anti-cAMP responsive element binding protein 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 37 kDa
• species reactivity: pig, mouse, rat, bovine, canine, horse, zebrafish, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_604391
• UniProt accession no.: P16220
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CREB1(1385)

Descripción

General description

CREB1 is a leucine zipper transcription factor that interacts with cAMP-responsive element. Rabbit Anti-CREB1 (AB2) antibody recognizes zebrafish, human, mouse, rat, canine, pig, chicken, and bovine CREB1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CREB1

Application

Rabbit Anti-CREB1 (AB2) antibody can be used for western blot assays at 1μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: DSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable