Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

MAB2290

Sigma-Aldrich

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon®, from mouse

Sinónimos:

CD49c

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
509,00 €

509,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
100 μG
509,00 €

About This Item

Código UNSPSC:
12352203
eCl@ss:
32160702
NACRES:
NA.41

509,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

origen biológico

mouse

Nivel de calidad

forma del anticuerpo

purified antibody

tipo de anticuerpo

primary antibodies

clon

29A3, monoclonal

reactividad de especies

human

fabricante / nombre comercial

Chemicon®

técnicas

immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable

isotipo

IgG1

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ITGA3(3675)

Descripción general

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

Especificidad

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Inmunógeno

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Aplicación

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

Forma física

Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.

Otras notas

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Información legal

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Opcional

Referencia del producto
Descripción
Precios

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Chi Ying Cheng et al.
Journal of virology, 85(2), 765-775 (2010-11-12)
Although human adenovirus type 5 (Ad5) has been widely studied, relatively little work has been done with other human adenovirus serotypes. The Ad5 E4orf6 and E1B55K proteins form Cul5-based E3 ubiquitin ligase complexes to degrade p53, Mre11, DNA ligase IV
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico