SAB2101136
Anti-IGF1R antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-CD221, Anti-IGFIR, Anti-Insulin-like growth factor 1 receptor, Anti-JTK13, Anti-MGC142170
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
71 kDa
species reactivity
pig, horse, sheep, bovine, dog, human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IGF1R(3480)
General description
Insulin-like growth factor 1 receptor (IGF1R), a transmembrane tyrosine kinase receptor, belongs to the insulin receptor family. It comprises juxtamembrane (JM) and transmembrane domains that harbor substrate binding sites. Structurally, IGF1R exists as a tetramer α2/β2 with the extracellular dimeric α subunits. The IGF1R gene is mapped to human chromosome 15q26.3.
Immunogen
Synthetic peptide directed towards the middle region of human IGF1R
Biochem/physiol Actions
Insulin-like growth factor 1 receptor (IGF1R) is prime for IGF-1 for its mitogenic and metabolic functionality. It binds to IGF1 and IGF2 and activates phosphatidylinositol 3?kinase (PI3K)/protein kinase B (AKT) and mitogen-activated protein kinase pathways. IGF1R plays a key role in growth, differentiation, cell metabolic events, and apoptosis. It also favors proliferation in the myelodysplastic syndrome (MDS) and may serve as a potential target to treat MDS. Mutations in the IGF1R gene are implicated in the pre- and postnatal growth retardation and microcephaly. High levels of IGF1R overexpression are observed in multiple myeloma, lung, breast, bladder and pancreatic tumors.
Sequence
Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Andrey S Kuznetsov et al.
Biochimica et biophysica acta. Biomembranes, 1862(11), 183417-183417 (2020-07-28)
Despite the biological significance of insulin signaling, the molecular mechanisms of activation of the insulin receptor (IR) and other proteins from its family remain elusive. Current hypothesis on signal transduction suggests ligand-triggered structural changes in the extracellular domain followed by
Nilda Gonzalez-Roibon et al.
Urology, 83(6), 1444-1444 (2014-04-10)
To assess the insulin-like growth factor-1 receptor (IGF1R) expression in urothelial carcinoma (UC) and its prognostic role in relation to clinicopathologic parameters. A total of 100 cases of invasive UC were evaluated using tissue microarrays. Membranous IGF1R staining was evaluated
Qi He et al.
Oncology reports, 44(3), 1094-1104 (2020-06-26)
Type 1 insulin‑like growth factor receptor (IGF‑IR) signaling is considered to serve a key role in the development of cancer. However, the effects of IGF‑IR on the malignant characteristics of myelodysplastic syndrome (MDS) clonal cells remains to be determined. In
Three novel IGF1R mutations in microcephalic patients with prenatal and postnatal growth impairment.
Matias Juanes et al.
Clinical endocrinology, 82(5), 704-711 (2014-07-22)
IGF1R gene mutations have been associated with varying degrees of intrauterine and postnatal growth retardation, and microcephaly. To identify and characterize IGF1R gene variations in a cohort of 28 Argentinean children suspected of having IGF-1 insensitivity, who were selected on
Dan Tian et al.
BMC systems biology, 8, 98-98 (2014-08-15)
The insulin-like growth factor (IGF) system impacts cell proliferation and is highly activated in ovarian cancer. While an attractive therapeutic target, the IGF system is complex with two receptors (IGF1R, IGF2R), two ligands (IGF1, IGF2), and at least six high
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico