WH0005111M2

Monoclonal Anti-PCNA antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-MGC8367, Anti-proliferating cell nuclear antigen
• Numéro MDL: MFCD00213036
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1G7, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: BC000491
• Numéro d'accès UniProt: P12004
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PCNA(5111)

Description

Description générale

Proliferating cell nuclear antigen (PCNA) is a ring-shaped homotrimer protein that is located at the center of the faithful duplication of eukaryotic genomes. Since it encircles the DNA, PCNA is also known as a sliding clamp. This gene is mapped to human chromosome 20p12.3.

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. (provided by RefSeq)

Immunogène

PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Application

Monoclonal Anti-PCNA antibody has been used in immunocytochemistry and western blotting.

Actions biochimiques/physiologiques

Proliferating cell nuclear antigen (PCNA) controls the production of the leading and lagging strands, that are required for the duplication of DNA. It acts as a cell cycle regulatory protein. This protein regulates apoptosis. PCNA is also involved in non-replicative DNA synthesis events.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)