Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

WH0004082M6

Sigma-Aldrich

Monoclonal Anti-MARCKS antibody produced in mouse

clone 2C2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-80KL, Anti-FLJ14368, Anti-MACS, Anti-MRACKS, Anti-PKCSL, Anti-PRKCSL, Anti-myristoylated alanine-rich protein kinase C substrate

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(5)

About This Item

Numéro MDL:
MFCD01633619
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2C2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

mouse

Technique(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

NM_002356

Numéro d'accès UniProt

P26645

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MARCKS(4082)

Catégories apparentées

Description générale

Myristoylated alanine-rich C-kinase substrate (MARCKS) contains an N-terminal domain (ND), effector domain (ED), and myristoylated MH2 domain. The MARCKS gene is mapped to human chromosome 6q21.

Immunogène

MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP

Application

Monoclonal Anti-MARCKS antibody produced in mouse has been used in immunohistochemistry (1:400).

Actions biochimiques/physiologiques

Myristoylated alanine-rich C-kinase substrate (MARCKS) is involved in mediating brain plasticity, inflammatory response, embryonic development, and regeneration processes. It also plays a key role in cell cycle regulation and transmembrane transport. Various studies have implicated the association of MARCKS with the pathophysiology of glioblastoma, cholangiocarcinoma, melanoma, and many more tumor types.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

John J Park et al.
Oncogenesis, 13(1), 9-9 (2024-02-29)
Protein kinase C (PKC) is activated downstream of gain-of-function GNAQ or GNA11 (GNAQ/GNA11) mutations in over 90% of uveal melanoma (UM). Phase I clinical trials of PKC inhibitors have shown modest response rates with no survival benefit in metastatic UM.
Mohamed El Amri et al.
Journal of biomedical science, 25(1), 43-43 (2018-05-24)
The Myristoylated Alanine-Rich C-kinase Substrate (MARCKS) and MARCKS-like protein 1 (MARCKSL1) have a wide range of functions, ranging from roles in embryonic development to adult brain plasticity and the inflammatory response. Recently, both proteins have also been identified as important
Hervé Ghesquieres et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 33(33), 3930-3937 (2015-10-16)
We performed a multistage genome-wide association study to identify inherited genetic variants that predict outcome in diffuse large B-cell lymphoma patients treated with immunochemotherapy. We conducted a meta-analysis of two genome-wide association study data sets, one from the LNH2003B trial
Krista Rombouts et al.
Cancer letters, 333(2), 244-252 (2013-02-05)
Several actin-binding proteins have been shown to be altered in metastatic cell lines and tumours and, in particular, Myristoylated Alanine-Rich protein Kinase C substrate (MARCKS) has been implicated in the pathogenesis of various highly metastatic epithelial malignancies. Considering that a
Ken-Ichi Dewa et al.
Nature communications, 15(1), 458-458 (2024-02-02)
In the central nervous system, astrocytes enable appropriate synapse function through glutamate clearance from the synaptic cleft; however, it remains unclear how astrocytic glutamate transporters function at peri-synaptic contact. Here, we report that Down syndrome cell adhesion molecule (DSCAM) in
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique