Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

SAE0105

Sigma-Aldrich

MT1 (Melatonin Receptor 1)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352202
Nomenclature NACRES :
NA.26

Produit recombinant

expressed in Sf9 cells

Description

N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.

Pureté

≥90% (SDS-PAGE)

Forme

aqueous solution

Poids mol.

44.8 kDa

Concentration

1 mg/mL

Numéro d'accès UniProt

P48039

Conditions d'expédition

dry ice

Température de stockage

−70°C

Actions biochimiques/physiologiques

Melatonin receptor 1 (MT1) is a class A GPCR that modulates neuronal firing, arterial vasoconstriction, cell proliferation in cancer cells, and reproductive and metabolic functions.

Séquence

MASAWSHPQFEKGGGSGGGSGGSAWSHPQFEKGAHHHHHHHHHHENLYFQGQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSSKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRQRVKPDRKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Notes préparatoires

Formulated in 25mM Na2HPO4 pH 8.0, 150mM NaCl, 0.86%/0.18% Sarkosyl/CHS.

Stockage et stabilité

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -80°C.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Shinobu Yasuo et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 29(9), 2885-2889 (2009-03-06)
Melatonin transmits photoperiodic signals that regulate reproduction. Two melatonin receptors (MT1 and MT2) have been cloned in mammals and additional melatonin binding sites suggested, but the receptor that mediates the effects of melatonin on the photoperiodic gonadal response has not
Benjamin Stauch et al.
Nature, 569(7756), E6-E6 (2019-05-03)
Change history: In this Letter, the rotation signs around 90°, 135° and 15° were missing and in the HTML, Extended Data Tables 2 and 3 were the wrong tables; these errors have been corrected online.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique