HPA030551
Anti-SLC43A3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-DKFZp762A227, Anti-Eeg1, Anti-FLJ32069, Anti-FOAP-13, Anti-PRO1659, Anti-SEEEG-1, Anti-solute carrier family 43, member 3
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SLC43A3(29015)
Description générale
Solute carrier family 43 member 3 (SLC43A3) belongs to an amino acid transporter family. It is expressed in fetal liver, kidney, placenta and lung. It is considered as a facilitative and purine-selective nucleobase transporter. The gene is located on human chromosome 11q12.1.
Immunogène
solute carrier family 43, member 3 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Actions biochimiques/physiologiques
Solute carrier family 43 member 3 (SLC43A3) aids the cellular uptake of extracellular purine nucleobases in assistance with salvage enzymes. SLC43A3 along with salvage enzymes helps in tumor growth and proliferation. It helps in the uptake of ganciclovir (GCV) and improves the activity of herpes simplex virus thymidine kinase (HSV-TK)/GCV suicide gene therapy. The protein helps in the transport of nutrients, which is required for the early development and growth.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST72623
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Functional identification of SLC43A3 as an equilibrative nucleobase transporter involved in purine salvage in mammals
Furukawa J, et al.
Scientific Reports, 5(6), 15057-15057 (2015)
Role of equilibrative nucleobase transporter 1/SLC43A3 as a ganciclovir transporter in the induction of cytotoxic effect of ganciclovir in a suicide gene therapy with herpes simplex virus thymidine kinase
Furukawa J, et al.
Journal of Pharmacology and Experimental Therapeutics, 360(1), 59-68 (2017)
A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci
Kenny EE, et al.
PLoS Genetics, 8(3), e1002559-e1002559 (2012)
Nicholas M Ruel et al.
The Journal of pharmacology and experimental therapeutics, 382(3), 335-345 (2022-07-08)
6-Mercaptopurine (6-MP) is used extensively in the treatment of acute lymphoblastic leukemia (ALL) and inflammatory bowel diseases. Our laboratory determined previously, using a recombinant HEK293 cell model, that the SLC43A3-encoded equilibrative nucleobase transporter 1 (ENBT1) transports 6-MP into cells and
Nayiar Shahid et al.
Drug metabolism and disposition: the biological fate of chemicals, 52(10), 1094-1103 (2024-07-26)
Equilibrative nucleoside transporters (ENTs) mediate the transmembrane flux of endogenous nucleosides and nucleoside analogs used clinically. The predominant subtype, ENT1, has been well characterized. However, the other subtype, ENT2, has been less well characterized in its native milieu due to
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique