Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

HPA024802

Sigma-Aldrich

Anti-SLC19A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FOLT, Anti-solute carrier family 19 (folate transporter), member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

Séquence immunogène

AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC19A1(6573)

Description générale

The gene SLC19A1 (solute carrier family 19 member 1) is mapped to human chromosome 21q22. It is expressed in many tissues, mainly enterocytes and hepatocytes.

Immunogène

solute carrier family 19 (folate transporter), member 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-SLC19A1 antibody produced in rabbit has been used in western blotting.

Actions biochimiques/physiologiques

At physiological pH, SLC19A1 (solute carrier family 19 member 1) is involved in the transfer of reduced folates into the cells. It is also involved in the uptake of the antifolate methotrexate. In osteosarcoma and neuroblastoma, decrease in the activity of SLC19A1 leads to methotrexate resistance. In patients with colorectal cancer, high expression of SLC19A1 reduces risk of recurrent disease (disease-free survival). SLC19A1 might be linked with non-syndromic cleft lip and palate and neural tube defects. Additionally, mutations in SLC19A1 gene are associated with risk of ischemic stroke.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73240

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Elixabet Lopez-Lopez et al.
The Journal of clinical investigation, 130(12), 6600-6615 (2020-11-10)
BACKGROUNDInterpatient differences in the accumulation of methotrexate's active polyglutamylated metabolites (MTXPGs) in leukemia cells influence its antileukemic effects.METHODSTo identify genomic and epigenomic and patient variables determining the intracellular accumulation of MTXPGs, we measured intracellular MTXPG levels in acute lymphoblastic leukemia
Adipocyte expression of SLC19A1 links DNA hypermethylation to adipose tissue inflammation and insulin resistance
Petrus P, et al.
The Journal of Clinical Endocrinology and Metabolism, 103(2), 710-721 (2017)
H L Hébert et al.
The British journal of dermatology, 166(3), 474-482 (2011-11-05)
The era of genome-wide association studies has revolutionized the search for genetic susceptibility loci in complex genetic conditions such as psoriasis. There are currently 16 loci with confirmed evidence for association with psoriasis susceptibility but there is the potential for
Diana T Lau et al.
Oncotarget, 6(17), 15510-15523 (2015-04-11)
MYCN amplification occurs in 20% of neuroblastomas and is strongly related to poor clinical outcome. We have identified folate-mediated one-carbon metabolism as highly upregulated in neuroblastoma tumors with MYCN amplification and have validated this finding experimentally by showing that MYCN
Aurea Lima et al.
Toxicological sciences : an official journal of the Society of Toxicology, 142(1), 196-209 (2014-08-16)
Methotrexate (MTX) is used for rheumatoid arthritis (RA) treatment showing a wide toxicity profile. This study aimed to evaluate the influence of single nucleotide polymorphisms (SNPs) in genes encoding for MTX transporters with the occurrence of MTX-related toxicity (overall and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique