WH0388591M2

Monoclonal Anti-FLJ46380 antibody produced in mouse

clone 1C5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-FLJ46380 protein
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1C5, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: NM_207396
• UniProt-Hinterlegungsnummer: Q6ZRF8
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... RNF207(388591)

Beschreibung

Allgemeine Beschreibung

FLJ46380 is also known as ring finger protein 207 (RNF207). It is an E3 ligase expressed in the heart. The gene encoding it is located on human chromosome 1p36.31.

Immunogen

FLJ46380 (NP_997279, 135 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HVFRGRPGSGFSSTSLGHLGPKCEPHYTGGETEVQNKGLEPVSRQWQRLRPFDLGRAHWSPIQGGVVDLHRRGSPVCRPGPTLKGLCYPSGIEAATAQGRWGQHAVPSGL

Biochem./physiol. Wirkung

FLJ46380 or ring finger protein 207 (RNF207) has been studied as a marker for acute myocardial infarction.

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)