WH0000108M1

Monoclonal Anti-ADCY2 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-HBAC2, Anti-KIAA1060, Anti-MGC133314, Anti-adenylate cyclase 2 (brain)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1D4, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; proximity ligation assay: suitable
• Isotyp: IgG2bκ
• GenBank-Hinterlegungsnummer: NM_020546
• UniProt-Hinterlegungsnummer: Q08462
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ADCY2(108)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. (provided by RefSeq)

Immunogen

ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)