SAB2108747

Anti-TMPRSS6

affinity isolated antibody

• Synonym(e): Anti-IRIDA
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 90 kDa
• Speziesreaktivität: pig, rat, human, horse, bovine, mouse
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• Hinterlegungsnummer: NM_153609
• UniProt-Hinterlegungsnummer: Q8IU80
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TMPRSS6(164656)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human TMPRSS6

Biochem./physiol. Wirkung

TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.

Sequenz

Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable