Synthetic peptide directed towards the C terminal of human KCNH8
Biochem./physiol. Wirkung
Kcnh8 is a pore-forming (alpha) subunit of voltage-gated potassium channel. It elicits a slowly activating, outward rectifying current. Channel properties may be modulated by cAMP and subunit assembly.
Sequenz
Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..