SAB2105397

Anti-MAFA, (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-RIPE3b1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 37 kDa
• Speziesreaktivität: human, rat, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_194350
• UniProt-Hinterlegungsnummer: Q8CF90
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MAFA(389692) ; mouse ... Mafa(378435)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal of human Mafa

Biochem./physiol. Wirkung

Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.

Sequenz

Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable