SAB2104632

Anti-GSX1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-GSH1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 28 kDa
• Speziesreaktivität: bovine, mouse, dog, rabbit, human, rat, pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_145657
• UniProt-Hinterlegungsnummer: Q9H4S2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GSX1(219409)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human GSX1

Biochem./physiol. Wirkung

GSX1 is a probable transcription factor that binds to the DNA sequence 5′-GC[TA][AC]ATTA[GA]-3′. GSX1 activates the transcription of the GHRH gene. GSX1 plays an important role in pituitary development.

Sequenz

Synthetic peptide located within the following region: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHAR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable