SAB2100988

Anti-GTF2E2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-FE, Anti-General transcription factor IIE, polypeptide 2, β 34kDa, Anti-TF2E2, Anti-TFIIE-B
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 33 kDa
• Speziesreaktivität: rabbit, goat, rat, mouse, dog, guinea pig, horse, bovine, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: P29084
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... GTF2E2(2961)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human GTF2E2

Biochem./physiol. Wirkung

GTF2E2 belongs to the TFIIE beta subunit family.It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.

Sequenz

Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable