SAB2100188

Anti-ATPIF1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-ATPI, Anti-ATPIP, Anti-ATPase inhibitory factor 1, Anti-IP, Anti-MGC1167
• MDL-Nummer: MFCD02263389
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 12 kDa
• Speziesreaktivität: horse, dog, bovine, rabbit, human, rat, guinea pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: Q9UII2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ATPIF1(93974)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human ATPIF1

Biochem./physiol. Wirkung

ATPIF1 is a mitochondrial ATPase inhibitor. It is thought to be a regulatory component of the ATP-synthesizing complex in the mitochondria.This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Sequenz

Synthetic peptide located within the following region: GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable