SAB1404529

Monoclonal Anti-WRN, (C-terminal) antibody produced in mouse

clone 2F7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): DKFZp686C2056, RECQ3, RECQL2, RECQL3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2F7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~38.32 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: NM_000553
• UniProt-Hinterlegungsnummer: Q14191
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... WRN(7486)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3′ to 5′ DNA helicase activity, and is also a 3′ to 5′ exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging. (provided by RefSeq)

Immunogen

WRN (NP_000544, 1322 a.a. ~ 1432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable