SAB1402841

Monoclonal Anti-MATK, (C-terminal) antibody produced in mouse

clone 2C5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2C5, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~35.57 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_139355
• UniProt-Hinterlegungsnummer: P42679
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MATK(4145)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. (provided by RefSeq)

Immunogen

MATK (NP_647612, 422 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable