HPA044948

Anti-MIIP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Flj12438, Anti-Iip45, Anti-Migration and invasion inhibitory protein
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA044948
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
• UniProt-Hinterlegungsnummer: Q5JXC2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MIIP(60672)

Beschreibung

Allgemeine Beschreibung

Migration and invasion inhibitory protein (MIIP), also called insulin-like growth factor binding protein 2 (IGFBP2), is expressed in fetal tissues and astroglial cells. It has an insulin-like growth factor (IGF) binding motif. It is a tumor-suppressor gene and is mapped to human chromosome 1p36.22. It has a C-terminal polyproline domain.

Immunogen

migration and invasion inhibitory protein recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-MIIP antibody produced in rabbit has been used in western blotting and in immunoprecipitation detection of MIIP in colorectal cancer cells.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

Migration and invasion inhibitory protein (MIIP), binds to insulin-like growth factor (IGF) and modulates cancer progression. It is under expressed in brain tumor, invasive glioblastoma multiforme. MIIP is a tumor suppressor gene and inhibits rat sarcoma (Ras)-related C3 botulinum toxin substrate 1- guanosine triphosphate (Rac1-GTP) mediated cell migration in endometrial carcinoma. Single nucleotide polymorphism in MIIP is associated with increased risk of breast cancer. MIIP inhibits non-small cell lung cancer progression by lowering epidermal growth factor receptor (EGFR) expression. Haploinsufficiency of MIIP is implicated in the colorectal tumor progression.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST76605

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable