Direkt zum Inhalt
Merck

HPA026830

Sigma-Aldrich

Anti-PHF13 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-PHD finger protein 13

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
541,00 €

541,00 €


Check Cart for Availability


Größe auswählen

Ansicht ändern
100 μL
541,00 €

About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.43

541,00 €


Check Cart for Availability

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Immunogene Sequenz

GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... PHF13(148479)

Allgemeine Beschreibung

The gene PHD finger protein 13 (PHF13), also known as survival time associated PHD finger protein in Ovarian Cancer 1 (SPOC1), is mapped to human chromosome 1p36.3, a region associated with chromosomal instability and tumor development.s The gene codes for a 34kDa nuclear protein containing 300 amino acids. The protein is characterized with a C-terminal single PHD (plant homeodomain) involved in chromatin specific interactions and a bipartite nuclear localization sequence. PHF13 mRNA is ubiquitously expressed at a low level in all tissues and it is expressed at high level in the testis and ovaries.

Immunogen

PHD finger protein 13 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

PHD finger protein 13 (PHF13) or survival time associated PHD finger protein in ovarian cancer 1 (SPOC1) is a tightly regulated chromatin-associated protein, involved in chromatin structure modulation. The encoded protein helps in proper mitotic chromosome condensation and cell division. PHF13 /SPOC1 might have a role in cell proliferation and oncogenesis. SPOC1 is crucial for spermatogonial stem cell differentiation and spermatogenesis. Elevated expression of SPOC1 leads to unresectable carcinomas and decreased survival rates in ovarian cancer patients. SPOC1/ PHF13 plays a vital role in radiosensitivity and DNA damage repair with the help of chromatin modifiers and DDR (DNA damage response) regulators.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72593

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

SPOC1, a novel PHD-finger protein: association with residual disease and survival in ovarian cancer.
Mohrmann G
International Journal of Cancer. Journal International Du Cancer, 116(4), 547-554 (2005)
SPOC1 (PHF13) is required for spermatogonial stem cell differentiation and sustained spermatogenesis.
Bordlein A
Journal of Cell Science, 124(pt18), 3137-3148 (2011)
SPOC1: a novel PHD-containing protein modulating chromatin structure and mitotic chromosome condensation.
Kinkley S
Journal of Cell Science, 122(pt16), 2946-2956 (2009)
SPOC1-mediated antiviral host cell response is antagonized early in human adenovirus type 5 infection.
Schreiner S
PLoS Pathogens, 9(11) (2013)

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.