Direkt zum Inhalt
Merck

HPA019021

Sigma-Aldrich

Anti-SERTAD2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(e):

Anti-SERTA domain-containing protein 2, Anti-TRIP-Br2, Anti-Transcriptional regulator interacting with the PHD-bromodomain 2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
541,00 €

541,00 €


Voraussichtliches Versanddatum28. Mai 2025



Größe auswählen

Ansicht ändern
100 μL
541,00 €

About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

541,00 €


Voraussichtliches Versanddatum28. Mai 2025


Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

independent
recombinant expression
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

Immunogene Sequenz

DGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDDDTFCTSQ

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SERTAD2(9792)

Allgemeine Beschreibung

The gene SERTAD2 (SERTA domain-containing protein 2) is mapped to human chromosome 2p14. It belongs to TRIP-Br (transcriptional regulator interacting with the PHD-bromodomain) family of proteins. The expression of SERTAD2 is highest at the G1/S boundary. The protein localizes in the cytoplasm and the nucleus. It is generally referred to as TRIP-Br2.

Immunogen

SERTA domain-containing protein 2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

SERTAD2 (SERTA domain-containing protein 2) plays a crucial role in regulating cell cycle progression. Overexpression of SERTAD2 stimulates E2F (retinoblastoma-associated protein) activity and enhances tumorigenesis. It is up-regulated in prostate carcinoma, squamous cell lung carcinoma, lung adenocarcinoma, ovarian cyst adenocarcinoma, colorectal carcinoma, renal cell carcinoma, osteosarcoma and hepatocellular carcinoma. Interestingly, SERTAD2 also regulates adipocyte lipolysis, thermogenesis and oxidative metabolism, and thereby modulates fat storage in adipose tissue.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73758

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Jit Kong Cheong et al.
Journal of translational medicine, 7, 8-8 (2009-01-21)
Members of the TRIP-Br/SERTAD family of mammalian transcriptional coregulators have recently been implicated in E2F-mediated cell cycle progression and tumorigenesis. We, herein, focus on the detailed functional characterization of the least understood member of the TRIP-Br/SERTAD protein family, TRIP-Br2 (SERTAD2).
I-Lu Lai et al.
Gene, 388(1-2), 102-109 (2006-12-05)
TRIP-Brs are a recently discovered set of proteins whose functions remain poorly characterized. Here we report the identification of TRIP-Br3 as a member of the TRIP-Br family along with evidence showing that TRIP-Brs interact with bromodomain-containing transcriptional cofactors PCAF, STAF65gamma
Jit Kong Cheong et al.
The Journal of biological chemistry, 283(17), 11661-11676 (2008-03-05)
Overexpression of the proto-oncogene TRIP-Br2 (SERTAD2) has been shown to induce E2F activity and promote tumorigenesis, whereas ablation of TRIP-Br2 arrests cell proliferation. Timely degradation of many cell cycle regulators is fundamental to the maintenance of proper cell cycle progression.
Chong Wee Liew et al.
Nature medicine, 19(2), 217-226 (2013-01-08)
Obesity develops as a result of altered energy homeostasis favoring fat storage. Here we describe a new transcription co-regulator for adiposity and energy metabolism, SERTA domain containing 2 (TRIP-Br2, also called SERTAD2). TRIP-Br2-null mice are resistant to obesity and obesity-related

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.