Synthetic peptide directed towards the C terminal region of human ASB5
Anwendung
Anti-ASB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem./physiol. Wirkung
Ankyrin repeat and SOCS box containing 5 (ASB5) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins. These proteins regulate protein turnover by targeting proteins for polyubiquitination and proteasome-mediated degradation. It is expressed in endothelial cells and smooth muscle cells and is involved in arteriogenesis.
Sequenz
Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Trends in biochemical sciences, 27(5), 235-241 (2002-06-22)
Although initially identified in the suppressor of cytokine signaling (SOCS) family of proteins, the C-terminal SOCS box has now been identified in more than 40 proteins in nine different families. Growing evidence suggests that the SOCS box, similar to the
Biochemical and biophysical research communications, 302(1), 17-22 (2003-02-21)
Arteriogenesis, the growth of pre-existing collateral arteries, can be induced in rabbit by occlusion of the femoral artery. In order to identify and characterize genes differentially expressed during the early phase of arteriogenesis, cDNA of collateral arteries 24h after femoral
Fragen
Bewertungen
★★★★★ Kein Beurteilungswert
Aktive Filter
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
