Direkt zum Inhalt
Merck

AV49458

Sigma-Aldrich

Anti-TRPV5 antibody produced in rabbit

affinity isolated antibody

Synonym(e):

Anti-CAT2, Anti-ECAC1, Anti-OTRPC3, Anti-Transient receptor potential cation channel, subfamily V, member 5

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

82 kDa

Speziesreaktivität

human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

immunohistochemistry: suitable
western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... TRPV5(56302)

Allgemeine Beschreibung

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) belongs to transient receptor potential (TRP) cation channels family. All TRP channels contain transmembrane helices and CaM (calmodulin) binding sites. TRPV5 is highly expressed in kidney, small intestine and pancreas. Low levels of TRPV5 are observed in testis, prostate, placenta, brain, colon and rectum. TRPV5 has also been reported in human parathyroid glands.[1] The protein mianly localizes at the plasma membrane.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRPV5

Anwendung

Anti-TRPV5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem./physiol. Wirkung

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) is an epithelial transmembrane calcium-selective channel. TRPV5 mediates renal calcium reabsorption[2] and mutations in this gene result in hypercalciuria.[3] TRPV5 also controls levels of cadmium and zinc in cells. WNK3, the With No Lysine (K) family membre, positively regulate TRPV5.

Sequenz

Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

12 - Non Combustible Liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Laura Giusti et al.
Journal of cellular and molecular medicine, 18(10), 1944-1952 (2014-08-29)
The parathyroid glands play an overall regulatory role in the systemic calcium (Ca(2+)) homeostasis. The purpose of the present study was to demonstrate the presence of the Ca(2+) channels transient receptor potential vanilloid (TRPV) 5 and TRPV6 in human parathyroid
Gergely Kovacs et al.
Cell calcium, 54(4), 276-286 (2013-08-24)
TRPV5 and TRPV6 are two major calcium transport pathways in the human body maintaining calcium homeostasis. TRPV5 is mainly expressed in the distal convoluted and connecting tubule where it is the major, regulated pathway for calcium reabsorption. TRPV6 serves as
Nadezda V Kovalevskaya et al.
Journal of structural and functional genomics, 13(2), 91-100 (2012-02-23)
The epithelial Ca(2+) channels TRPV5/6 (transient receptor potential vanilloid 5/6) are thoroughly regulated in order to fine-tune the amount of Ca(2+) reabsorption. Calmodulin has been shown to be involved into calcium-dependent inactivation of TRPV5/6 channels by binding directly to the
Nellie Y Loh et al.
PloS one, 8(1), e55412-e55412 (2013-02-06)
Hypercalciuria is a major cause of nephrolithiasis, and is a common and complex disorder involving genetic and environmental factors. Identification of genetic factors for monogenic forms of hypercalciuria is hampered by the limited availability of large families, and to facilitate
Olena Andrukhova et al.
The EMBO journal, 33(3), 229-246 (2014-01-18)
αKlotho is thought to activate the epithelial calcium channel Transient Receptor Potential Vanilloid-5 (TRPV5) in distal renal tubules through its putative glucuronidase/sialidase activity, thereby preventing renal calcium loss. However, αKlotho also functions as the obligatory co-receptor for fibroblast growth factor-23

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.