AV36000

Anti-HES4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Hairy and enhancer of split 4 (Drosophila)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 24 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001135939
• UniProt-Hinterlegungsnummer: Q9HCC6
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... HES4(57801)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human HES4

Biochem./physiol. Wirkung

HES4 has been identified as transcriptional repressor that is positively regulated by Wnt signaling pathway. In conjunction with Notch signaling targets, Hes proteins regulate cell differentiation, embryonic patterning and cell fate decisions.

Sequenz

Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable