Synthetic peptide directed towards the N terminal region of human CCNG2
Anwendung
Anti-CCNG2 antibody is suitable for western blotting at a concentration of 2.5 μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper)
Biochem./physiol. Wirkung
Cyclin G2 is an unconventional cyclin protein that shuttles between nucleus and cytoplasm and is linked to growth inhibition and cell differentiation. Overexpression of CyclinG2 results in p53-dependent arrest of cell cycle in G1/S phase. It enforces G2/M cell cycle arrest in collaboration with DNA damage checkpoint signaling.
Sequenz
Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Biochemical journal, 457(1), 69-77 (2013-09-26)
The mechanisms whereby insulin analogues may cause enhanced mitogenicity through activation of either the IR (insulin receptor) or the IGF-IR (insulin-like growth factor 1 receptor) are incompletely understood. We demonstrate that in L6 myoblasts expressing only IGF-IRs as well as
The Journal of biological chemistry, 287(27), 22838-22853 (2012-05-17)
To maintain genomic integrity DNA damage response (DDR), signaling pathways have evolved that restrict cellular replication and allow time for DNA repair. CCNG2 encodes an unconventional cyclin homolog, cyclin G2 (CycG2), linked to growth inhibition. Its expression is repressed by
A simple biochemical method to isolate mRNAs pulled down with a transfected, biotinylated microRNA was used to identify direct target genes of miR-34a, a tumor suppressor gene. The method reidentified most of the known miR-34a regulated genes expressed in K562
Fragen
Bewertungen
★★★★★ Kein Beurteilungswert
Aktive Filter
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..